SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R6S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R6S4
Domain Number 1 Region: 307-468
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-41
Family Dual specificity phosphatase-like 0.00088
Further Details:      
 
Domain Number 2 Region: 272-319
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000183
Family DEK C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R6S4
Sequence length 659
Comment (tr|G3R6S4|G3R6S4_GORGO) Slingshot protein phosphatase 3 {ECO:0000313|Ensembl:ENSGGOP00000011041} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SSH3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MALVTVSRSPPGSGASTPVGPWDRAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEEAPSEEELRGDQMDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAA
RPPRLRYLLVVSTREGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGG
FSVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQ
SCLNEWTTMADLESLRPPSAEPGRSSEQEQMEQAIRAELWKVLDASDLESVTSKEIRQAL
ELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILN
MAREIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRS
AATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKV
GGVSPEERPAPEVSTPFPPLPPEPGGGGEEKVVGMEESQAAPKEKPGPRPRINLRGIMRS
ISLLEPSLELESTSETSDMPEVFSSHESSHEEPLQPFPQLARTKGGQQVDRGPQPALKSR
QSVVTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQASVHDSGEEGEA
Download sequence
Identical sequences G3R6S4
ENSGGOP00000011041 ENSGGOP00000011041 XP_004051676.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]