SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R9H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R9H9
Domain Number 1 Region: 416-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 597-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-20
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 3 Region: 710-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 769-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000564
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 836-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 532-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 241-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000366
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R9H9
Sequence length 994
Comment (tr|G3R9H9|G3R9H9_GORGO) Seizure related 6 homolog {ECO:0000313|Ensembl:ENSGGOP00000012062} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SEZ6 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRPVALLLLPSLLALLAHGLSLEAPTVGKGQAPGIEETDGELTAAPTPEQPERGIHFVTT
APTLKLLNHHPLLEEFLQEGLEKGDEELRPALPFQPDPPTLFTPSPLPRLANQDSRPVFT
SPTPAMAAVPTQPQSKEGPWSPESESPMLRITAPLPLGPSMAVPTLGPGEIASTTPPSRA
WTPTQEGPGDMGRPWVAEAVSQGAGIGIQGTITSSTASGDDEETTTTTTIITTTITTVQT
PGPCSWNFSGPEGSLDSPTDLSSPTDVGLDCFFYISVYPGYGVEIKVQNISLREGETVTV
EGLGGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFP
HRPAYGDVTVTSLHPGGSARFHCATGYQLKGARHLTCLNATQPFWDSKEPVCIAACGGVI
RNATTGRIVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVE
APPVYDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYG
NFSSSAPTYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDS
AGVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLG
QYSGPRSHFKLFTSMADVTIQFQSDPGTSVLGYEQGFVIHFFEVPRNDTCPELPEIPNGW
KSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHS
RRLISSPKFPVGATVQYICDQGFVLTGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHG
LSAPENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASL
DGFYNSRSLDVAKAPAASSTLDAAHIAAAIFLPLVAMVLLVGGVYFYFSRLQGKSSLQLP
RPRPRPYNRITIESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences G3R9H9
XP_004042076.1.27298 ENSGGOP00000012062 ENSGGOP00000012062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]