SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RAV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RAV6
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000485
Family Ngr ectodomain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RAV6
Sequence length 177
Comment (tr|G3RAV6|G3RAV6_GORGO) Glycoprotein IX platelet {ECO:0000313|Ensembl:ENSGGOP00000012588} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GP9 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPVWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAVLGLALLAGLLCATTEALD
Download sequence
Identical sequences G3RAV6
ENSGGOP00000012588 XP_004036316.1.27298 ENSGGOP00000012588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]