SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RAW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RAW9
Domain Number 1 Region: 238-300
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.77e-18
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 297-363
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.18e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 177-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.86e-16
Family LIM domain 0.0029
Further Details:      
 
Domain Number 4 Region: 116-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000286
Family LIM domain 0.019
Further Details:      
 
Domain Number 5 Region: 359-387
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000104
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RAW9
Sequence length 388
Comment (tr|G3RAW9|G3RAW9_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000012601} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTRRVFSRAGAAQRSTRPAAEPQPPAARALQPRPGVPGPLRRREYLQPAPRREAEGLSHQ
GSEEGAESGARPRERGAEPELGRLWLRTVSSWRLGWHFDFGVAEKPGVKMTERFDCHHCN
ESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQC
RNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHR
CQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTAC
RKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNC
KKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences G3RAW9
ENSGGOP00000012601 ENSGGOP00000012601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]