SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RBW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RBW7
Domain Number 1 Region: 1-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.27e-102
Family Protein kinases, catalytic subunit 0.000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RBW7
Sequence length 297
Comment (tr|G3RBW7|G3RBW7_GORGO) Cyclin dependent kinase 1 {ECO:0000313|Ensembl:ENSGGOP00000012982} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CDK1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Download sequence
Identical sequences A0A2J8WR14 G3RBW7 H2R7P8 P06493
4yc6_A 4yc6_C 4yc6_E 4yc6_G ENSPTRP00000050657 ENSP00000378699 ENSGGOP00000012982 ENSGGOP00000012982 gi|4502709|ref|NP_001777.1| ENSP00000325970 ENSP00000378699 HR2896 ENSPTRP00000050657 d4yc3a1 NP_001307847.1.87134 NP_001307847.1.92137 NP_001777.1.87134 NP_001777.1.92137 XP_003830379.1.60992 XP_004049500.1.27298 XP_004049502.2.27298 XP_005270360.1.92137 XP_018891055.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]