SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RBX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RBX6
Domain Number 1 Region: 34-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-51
Family Ankyrin repeat 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RBX6
Sequence length 304
Comment (tr|G3RBX6|G3RBX6_GORGO) Ankyrin repeat domain 16 {ECO:0000313|Ensembl:ENSGGOP00000012992} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ANKRD16 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAW
GMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVI
QELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAM
HGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGA
QALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKPCIWPVQVSTWPVPSFS
CSRD
Download sequence
Identical sequences G3RBX6
gi|58331117|ref|NP_001009943.1| ENSP00000352361 NP_001009943.1.87134 NP_001009943.1.92137 XP_004049073.1.27298 ENSP00000352361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]