SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RCR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RCR9
Domain Number 1 Region: 88-200
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-21
Family SH2 domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RCR9
Sequence length 399
Comment (tr|G3RCR9|G3RCR9_GORGO) SH2 domain containing 2A {ECO:0000313|Ensembl:ENSGGOP00000013303} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SH2D2A OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCRNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRRVRPPLSVTHREAERLLE
PKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLGDGRHVVLGEDSAHARLQDLLRHY
TAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQ
KEGAGEKETSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFY
AMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
Download sequence
Identical sequences G3RCR9
XP_004027047.1.27298 ENSGGOP00000013303 ENSGGOP00000013303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]