SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RDJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RDJ9
Domain Number 1 Region: 21-186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-32
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RDJ9
Sequence length 201
Comment (tr|G3RDJ9|G3RDJ9_GORGO) Protein tyrosine phosphatase, mitochondrial 1 {ECO:0000313|Ensembl:ENSGGOP00000013606} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PTPMT1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITAGTTKDGTFDISKT
Download sequence
Identical sequences G3RDJ9
XP_018892095.1.27298 ENSGGOP00000013606 ENSGGOP00000013606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]