SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RDS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RDS8
Domain Number 1 Region: 549-736
Classification Level Classification E-value
Superfamily Sec7 domain 1.1e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 752-883
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000116
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RDS8
Sequence length 949
Comment (tr|G3RDS8|G3RDS8_GORGO) IQ motif and Sec7 domain 2 {ECO:0000313|Ensembl:ENSGGOP00000013689} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=IQSEC2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEPPGRSSRSTASHTLHQYCCPTQVLDSMKLTPSGRLAESSVEGDAPGSDLSTAVDSPGS
QPPYRLSQLPPSSSHMGGPPAGVGLPWAQRARLQPASVALRKQEEEEIKRSKALSDSYEL
STDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIIL
SNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGS
SVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQ
EDSSATSFSDLPLYLDDTVPQQSPERLPSTEPPPQGRPEFWAPAPLPPVPPPVPSGTRED
GSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADG
CSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCE
AAGENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLCKQTYQRETRHSWDSP
AFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGE
FLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYC
VCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIP
RDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPN
RPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIK
LLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPN
ASQPGGAKDSVNGTMARSSLEDTYGAGDGLKRGALSSSLRDLSDAGVCY
Download sequence
Identical sequences A0A2J8RNM1 A0A2K5HUE7 A0A2K5NYY1 A0A2K5WL22 A0A2K5XWZ6 A0A2K6E2E4 A0A2K6LEY3 A0A2K6R9I0 G3RDS8 K7AFJ9
gi|53832026|ref|NP_055890.1| ENSP00000364514 NP_055890.1.87134 NP_055890.1.92137 XP_007989966.1.81039 XP_010362827.1.97406 XP_011825748.1.47321 XP_011894731.1.92194 XP_014982976.1.72884 ENSP00000364514 ENSP00000472754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]