SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RE19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RE19
Domain Number 1 Region: 284-406
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-28
Family SH2 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RE19
Sequence length 411
Comment (tr|G3RE19|G3RE19_GORGO) SH2 domain containing adaptor protein B {ECO:0000313|Ensembl:ENSGGOP00000013789} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SHB OC=Catarrhini; Hominidae; Gorilla.
Sequence
PGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGS
PHLYRSSSERRPATPAEVRYISPKHRLIKVESVAGGGAGDPLGGACAGGRTWSPTACGGK
KLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIM
TEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQ
PWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGER
VDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMK
LAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences G3RE19
ENSGGOP00000013789 ENSGGOP00000013789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]