SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3REB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3REB0
Domain Number 1 Region: 362-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3REB0
Sequence length 657
Comment (tr|G3REB0|G3REB0_GORGO) Protein tyrosine phosphatase, receptor type R {ECO:0000313|Ensembl:ENSGGOP00000013891} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PTPRR OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYQHSQDIEKSLDIAPQK
IYRHSYDSSSEAQVSKHHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPFSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCRQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
Download sequence
Identical sequences G3REB0
ENSGGOP00000013891 XP_004053614.1.27298 ENSGGOP00000013891 ENSGGOP00000022716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]