SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3REH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3REH2
Domain Number 1 Region: 461-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 132-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000171
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 9-95
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000128
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 4 Region: 212-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000253
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3REH2
Sequence length 767
Comment (tr|G3REH2|G3REH2_GORGO) Tyrosine-protein kinase receptor {ECO:0000256|RuleBase:RU000312} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NTRK2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
FIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLS
RKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQI
PNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLR
ITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNP
KPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDE
KQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHL
SVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISNDD
DSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKR
HNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNL
QHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLH
IAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTML
PIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRP
RTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences G3REH2
ENSGGOP00000013959 ENSGGOP00000013959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]