SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RFX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RFX5
Domain Number 1 Region: 1275-1417
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000114
Further Details:      
 
Domain Number 2 Region: 307-434
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-37
Family PLC-like (P variant) 0.004
Further Details:      
 
Domain Number 3 Region: 139-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-25
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 4 Region: 1122-1271
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 30-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RFX5
Sequence length 1419
Comment (tr|G3RFX5|G3RFX5_GORGO) Tensin 2 {ECO:0000313|Ensembl:ENSGGOP00000014508} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TNS2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMKPRKAEPHSFREKVFRKKPPVCAVCK
VTIDGTGISCRVCKVATHRKCEAKVTSACQALPPVELRRNTAPVRRIEHLGSTKSLNHSK
QRSTLPRSFSLDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHR
DKYLLFNLSEKRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLY
CKGNKGKLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFSGL
LSGSIRMNSSPLFLHYVLIPMLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQQL
CISLEPALLLKGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDE
RFPFQASVEFVFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDSVDGS
LTHTRGPLDGSPYAQVQRPPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGR
PPPTAAERQELDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSR
HCSCRQGYREPCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEG
LYPYPPEMGKPATGDFGYRTPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLE
REAGEGWASEAGKPLLHPVRPGHPLPLLLPACGHHHAPMPDYSCLKPPKAGEEGHEGCSY
TMCPEGRYGHPGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGS
ISPGSPPYPQSRKLSYEIPTEEGGDRYPLPGHLASAGPLASAESLEPVSWREGPSGHSTL
PRSPRDAPCSASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVS
QAGTGKAPELPSGSGPEPPVPSPVSPTFPPSSPSDWPQERSPGGHSDGASPRSPVPTTLP
GLRHAPWQGPRGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQ
PPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSNV
KFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPW
KGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDP
LEETPEAPVPTNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPT
PAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPEDRRWTNPDGTTSKIFGFVA
KKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences G3RFX5
ENSGGOP00000014508 XP_004053252.1.27298 ENSGGOP00000014508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]