SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RGC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RGC9
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.31e-31
Family Cytochrome b5 0.0000248
Further Details:      
 
Weak hits

Sequence:  G3RGC9
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Aquaporin-like 0.00235
Family Aquaporin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RGC9
Sequence length 150
Comment (tr|G3RGC9|G3RGC9_GORGO) Cytochrome b5 type B {ECO:0000313|Ensembl:ENSGGOP00000014673} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CYB5B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS
Download sequence
Identical sequences G3RGC9
ENSGGOP00000014673 XP_004057932.1.27298 ENSGGOP00000014673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]