SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RGF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RGF5
Domain Number 1 Region: 43-266
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.61e-58
Family Cytidylytransferase 0.00000000147
Further Details:      
 
Domain Number 2 Region: 271-430
Classification Level Classification E-value
Superfamily HAD-like 1.49e-22
Family Probable phosphatase YrbI 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RGF5
Sequence length 434
Comment (tr|G3RGF5|G3RGF5_GORGO) Cytidine monophosphate N-acetylneuraminic acid synthetase {ECO:0000313|Ensembl:ENSGGOP00000014703} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CMAS OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPL
KNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSS
TSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRW
SEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEM
RAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEI
ISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKE
MGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCTGGRGAIREFAEH
IFLLMEKVNNSCQK
Download sequence
Identical sequences G3RGF5
ENSGGOP00000014703 XP_004052909.1.27298 ENSGGOP00000014703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]