SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RIH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RIH1
Domain Number 1 Region: 141-322
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.08e-60
Family Brix domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RIH1
Sequence length 349
Comment (tr|G3RIH1|G3RIH1_GORGO) Ribosome production factor 1 homolog {ECO:0000313|Ensembl:ENSGGOP00000015473} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=RPF1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAKAGDKSSSGGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPND
EEVAYDEATDEFASYFNKQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCIARDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFRSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences G3RIH1
ENSGGOP00000015473 XP_004026097.1.27298 ENSGGOP00000015473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]