SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RIQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RIQ2
Domain Number 1 Region: 84-371
Classification Level Classification E-value
Superfamily L domain-like 8.42e-52
Family Ngr ectodomain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RIQ2
Sequence length 382
Comment (tr|G3RIQ2|G3RIQ2_GORGO) Proline and arginine rich end leucine rich repeat protein {ECO:0000313|Ensembl:ENSGGOP00000015564} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PRELP OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPP
PLPPGPPSIFPDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVE
SFQNATGLRWINLDNNRIRKIDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQ
NHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFQGLKNLMQLNLAHNILRKMPPRV
PTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN
YLKPPIPLDLMMCFRLLQSVVI
Download sequence
Identical sequences G3RIQ2
ENSGGOP00000015564 XP_004028240.1.27298 XP_018884557.1.27298 ENSGGOP00000015564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]