SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RJU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RJU5
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 8.02e-44
Family Globins 0.00000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RJU5
Sequence length 142
Comment (tr|G3RJU5|G3RJU5_GORGO) Hemoglobin subunit theta 1 {ECO:0000313|Ensembl:ENSGGOP00000015992} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HBQ1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSRLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALVSEYR
Download sequence
Identical sequences A0A1K0FU58 G3RJU5
ENSGGOP00000015992 ENSGGOP00000015992 XP_004056905.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]