SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RJW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RJW4
Domain Number 1 Region: 8-250
Classification Level Classification E-value
Superfamily HAD-like 1.07e-55
Family NagD-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RJW4
Sequence length 259
Comment (tr|G3RJW4|G3RJW4_GORGO) Haloacid dehalogenase like hydrolase domain containing 2 {ECO:0000313|Ensembl:ENSGGOP00000016014} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HDHD2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAARRALKAVLVDLSGTLHTEDAAVPGAQEALKRLRGASVIVRFVTNTTKESKQDLLERL
RKLEFDISEDEIFTSLTAARSLLEQKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPE
HFHYQNLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP
EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPP
YLTCESFPHAVDHILQHLL
Download sequence
Identical sequences G3RJW4
ENSGGOP00000016014 ENSGGOP00000016014 XP_018869625.1.27298 XP_018869626.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]