SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RK58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RK58
Domain Number 1 Region: 193-456
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.32e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RK58
Sequence length 465
Comment (tr|G3RK58|G3RK58_GORGO) Protein tyrosine phosphatase, non-receptor type 7 {ECO:0000313|Ensembl:ENSGGOP00000016118} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PTPN7 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MVGKAWPLTHSQAMGPWAPEGHRREAADPWWQRQQAQEGRMQLGCAWVAARRGGGRKLAS
WSLLSPQRQNDRQTDSWQEAAWGPQLLQQTSWLSEPPLGPAPHPSMVQAHGGRSRAQPLT
LSLEAAMTQPPPAKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFL
RTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSR
VCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLT
QLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEECRSVKHILFSAW
PDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARG
EVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Download sequence
Identical sequences G3RK58
ENSGGOP00000016118 ENSGGOP00000016118 XP_004028207.1.27298 XP_018884341.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]