SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RK73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RK73
Domain Number 1 Region: 9-290
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RK73
Sequence length 458
Comment (tr|G3RK73|G3RK73_GORGO) Tyrosine-protein phosphatase {ECO:0000256|RuleBase:RU364084} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PTPN18 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTEAGSRPENVRKN
RYKDVLPYDQTRVILSLLREEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLVMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPASPGHAMADTYAVVQKR
GAPAGAGRGTQTGTGTGARSAEEAPLYSQVTPRAQRPGAHAEDARGTLPGRIPADQSPAG
SGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Download sequence
Identical sequences G3RK73
ENSGGOP00000016133 ENSGGOP00000016133 XP_004032596.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]