SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RKD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RKD2
Domain Number 1 Region: 111-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.81e-72
Family Pyridoxal-dependent decarboxylase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RKD2
Sequence length 425
Comment (tr|G3RKD2|G3RKD2_GORGO) Glutamate decarboxylase 1 {ECO:0000313|Ensembl:ENSGGOP00000016197} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GAD1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDGFNFSQLANRIICLATELMTNKGCVTWHPNYSVNMHHGCLGRWAAHV
QEAPP
Download sequence
Identical sequences G3RKD2
ENSP00000434696 ENSP00000434696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]