SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RLN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RLN8
Domain Number 1 Region: 242-442
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.55e-76
Family STAT DNA-binding domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 106-248
Classification Level Classification E-value
Superfamily STAT 1.57e-35
Family STAT 0.00079
Further Details:      
 
Domain Number 3 Region: 445-560
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-34
Family SH2 domain 0.00022
Further Details:      
 
Domain Number 4 Region: 1-98
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.96e-30
Family Transcription factor STAT-4 N-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RLN8
Sequence length 652
Comment (tr|G3RLN8|G3RLN8_GORGO) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=STAT5A OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQCSSPAGILVDAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVS
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEG
SLDVLQSCECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTV
LFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKV
LWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNREN
LPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDS
EIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKY
YTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNP
DHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Download sequence
Identical sequences G3RLN8
ENSGGOP00000016693 ENSGGOP00000016693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]