SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RP48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RP48
Domain Number 1 Region: 210-493
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000505
Further Details:      
 
Domain Number 2 Region: 497-783
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RP48
Sequence length 793
Comment (tr|G3RP48|G3RP48_GORGO) Receptor-type tyrosine-protein phosphatase {ECO:0000256|PIRNR:PIRNR002006} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PTPRA OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSAAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTTATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALP
ACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQEKNK
FIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNIRVSV
EDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKA
CNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDM
QYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDK
MRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGP
LLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECE
SYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPIT
VHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQ
EYIDAFSDYANFK
Download sequence
Identical sequences G3RP48
XP_018872543.1.27298 ENSGGOP00000017567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]