SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RQG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RQG3
Domain Number 1 Region: 138-278
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.36e-28
Family FHA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RQG3
Sequence length 796
Comment (tr|G3RQG3|G3RQG3_GORGO) Solute carrier family 4 member 1 adaptor protein {ECO:0000313|Ensembl:ENSGGOP00000018036} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SLC4A1AP OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISRLHRSRMADILS
QSETLASQDLSGDFKKPALPVSPAARSKAPATSSSNPEEVQKEGPTALQDSNSGEPDIPP
PQPDCGDFRSLQEEQSRPPTAVSSPGGPARAPPYQEPPWGGPASAPYSLETLKGGTILGT
RSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTH
GTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQ
ILLEKKMLGEDSDEGEEMDTSERKINAGSQDDEMGCTWGMGEDAVEDDAEENPIVLEFQQ
EREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHS
GKKKEAMIQCSLEACRILDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLIEK
KRLNRMKKAGKIDEKPETFESLVAKLNDAERELSEISERLKASSQVLSESPSQDSLDAFM
SEIKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKIVKPAEIPELKKTETQTTGAENKA
KKLTLPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPTLMRMKDEPEVEEEEEEEEEEEKE
KEEHEKKKLEDGSLSRPQPEIEPEAAVQEMRPPTDLTHFKETQTHENMSQLSEEEQNKDY
QDCSKTTSLCAGPSASRNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDDPDYCVWVPPE
GQSGDGRTHLNDKYGY
Download sequence
Identical sequences G3RQG3
XP_004029073.1.27298 ENSGGOP00000018036 ENSGGOP00000018036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]