SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RR76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RR76
Domain Number 1 Region: 398-705
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.49e-55
Family Rhodopsin-like 0.00076
Further Details:      
 
Domain Number 2 Region: 39-253
Classification Level Classification E-value
Superfamily L domain-like 3.36e-30
Family Ngr ectodomain-like 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RR76
Sequence length 764
Comment (tr|G3RR76|G3RR76_GORGO) Thyrotropin receptor {ECO:0000256|RuleBase:RU361222} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TSHR OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRPADLLQLVLLLALPGDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPD
ALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSFLDVSQTSVTA
LPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTRNNAHYYVFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTVCGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
IMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAPISFYALSAILNKPLITVSNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQ
VQKVTHDMRQGLHNMQDVYELLENSHLTPKKQGQISEEYMQTVL
Download sequence
Identical sequences G3RR76
ENSGGOP00000008256 XP_004055580.1.27298 ENSGGOP00000008256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]