SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RSR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RSR8
Domain Number 1 Region: 103-370
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.18e-58
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000158
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RSR8
Sequence length 371
Comment (tr|G3RSR8|G3RSR8_GORGO) Haptoglobin {ECO:0000313|Ensembl:ENSGGOP00000018843} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HP OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRT
EGDGVYTLNNEKQWINKAVGDKLPECEAVYTLNDKKQWINKAVGDKLPECEAVCGKPKNP
ANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAK
DIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKNYAEV
GRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILN
EHTFCAGMSKYQEDTCYGDAGSAFAIHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSI
QDWVQKTIAEN
Download sequence
Identical sequences G3RSR8
ENSGGOP00000026525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]