SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RT55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RT55
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 5.96e-18
Family G-type lysozyme 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RT55
Sequence length 194
Comment (tr|G3RT55|G3RT55_GORGO) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LYG1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSALWLLLGLLALMDLSESSNWGCYGNIQTLDTPGASRGIGRRHGLNYCGVHASERLAEI
DMPYLLKYQPMMQTIGQKYCVDPAMIAGVLSRKSPGDKILVNVGDRTSMVQDPGSHAPTS
WISESQVSQTTEVLTTRIKEIQRRFPTWTSDQYLRGGLCAYSGGAGYVRSSQDLSCDFCN
GVLARAKYLKRHGF
Download sequence
Identical sequences G3RT55
ENSGGOP00000018980 ENSGGOP00000018980 XP_004031540.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]