SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RWR9
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily EF-hand 5.44e-19
Family S100 proteins 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RWR9
Sequence length 93
Comment (tr|G3RWR9|G3RWR9_GORGO) S100 calcium-binding protein {ECO:0000256|RuleBase:RU361184} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLTELEKALNSIIEVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKD
Download sequence
Identical sequences G3RWR9
ENSGGOP00000020253 ENSGGOP00000027573 ENSGGOP00000020253 ENSGGOP00000027573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]