SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RZ55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RZ55
Domain Number 1 Region: 438-497
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-17
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 
Domain Number 2 Region: 385-434
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000523
Family Erythroid transcription factor GATA-1 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RZ55
Sequence length 596
Comment (tr|G3RZ55|G3RZ55_GORGO) GATA binding protein 6 {ECO:0000313|Ensembl:ENSGGOP00000021097} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GATA6 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGLPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
XXXXXXXXXXXXXTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGG
GGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGS
SLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVL
HSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSK
MNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPR
PLAMKKEGIQTRKRKPKNINKSKTCSGNSSNSIPMTPTSTSSNSDDCSKNTSPTTQPTAS
GAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences G3RZ55
XP_004059281.1.27298 XP_018869856.1.27298 ENSGGOP00000021097 ENSGGOP00000025929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]