SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3S1X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S1X1
Domain Number 1 Region: 88-191
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.3e-33
Family PSF3 C-terminal domain-like 0.00000106
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.31e-22
Family PSF3 N-terminal domain-like 0.0000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3S1X1
Sequence length 216
Comment (tr|G3S1X1|G3S1X1_GORGO) GINS complex subunit 3 {ECO:0000313|Ensembl:ENSGGOP00000022067} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GINS3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAV
PQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKIGPHFYGFG
SQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQ
KGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
Download sequence
Identical sequences G3S1X1
XP_004057780.1.27298 ENSGGOP00000022067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]