SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3S3M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S3M7
Domain Number 1 Region: 54-108,213-313
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-42
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 6-75,106-159
Classification Level Classification E-value
Superfamily EF-hand 0.0000000146
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3S3M7
Sequence length 631
Comment (tr|G3S3M7|G3S3M7_GORGO) DEF6, guanine nucleotide exchange factor {ECO:0000313|Ensembl:ENSGGOP00000022677} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DEF6 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQR
QEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERK
LQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEE
AARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRLAQTRLLEEEEEKLKQLMQLKEEQ
ERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNV
KHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLARRDSSLKRLTRWGSQGNRTPSPNS
NEQQKSLNGGDEAPAPASTPQEDKLDPAPEN
Download sequence
Identical sequences A0A2I3RHJ1 G3S3M7
ENSPTRP00000030886 XP_003808575.1.60992 XP_004043914.1.27298 ENSPTRP00000030886 9598.ENSPTRP00000030886 ENSGGOP00000015810 ENSGGOP00000022677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]