SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3S3N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S3N2
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-43
Family Pentraxin (pentaxin) 0.00000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3S3N2
Sequence length 224
Comment (tr|G3S3N2|G3S3N2_GORGO) Pentraxin {ECO:0000256|RuleBase:RU362112} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CRP OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKGIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEESQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVRGEVFTKPQLWP
Download sequence
Identical sequences G3S3N2
XP_004027118.1.27298 ENSGGOP00000022682 ENSGGOP00000022682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]