SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3S5R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S5R3
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3S5R3
Sequence length 389
Comment (tr|G3S5R3|G3S5R3_GORGO) Mesoderm posterior bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSGGOP00000023419} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MESP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAQSPPPQSLLGHDHYIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPAPPSCS
SRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQ
GQGQGQGQGRGQGQGQGRRPRLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWAT
PPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTTAPATLELAAVYQ
GLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPWGCWSHSAEVVPNSEDQGPGATFQLSEAS
PAQSSGLRFSGCPELWQEDLEGARLGIFY
Download sequence
Identical sequences G3S5R3
ENSGGOP00000005560 XP_018866045.1.27298 ENSGGOP00000023419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]