SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3S692 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S692
Domain Number 1 Region: 26-157
Classification Level Classification E-value
Superfamily L domain-like 2.38e-22
Family Internalin LRR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3S692
Sequence length 184
Comment (tr|G3S692|G3S692_GORGO) Leucine rich repeat containing 20 {ECO:0000313|Ensembl:ENSGGOP00000023599} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRC20 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANN
ELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTSLP
ALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGAR
APLP
Download sequence
Identical sequences G3S692
XP_004049586.1.27298 XP_004049588.1.27298 ENSGGOP00000013768 ENSGGOP00000023599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]