SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SAR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SAR5
Domain Number 1 Region: 228-275
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.57e-16
Family TRASH domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SAR5
Sequence length 667
Comment (tr|G3SAR5|G3SAR5_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000025188} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDKCSVGGLEFTEQTPALLGNIAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDVV
FIESIQPPSVSAPAIADQRNFIFASSKNEKPQGNYSVIPPSRDLASQKGNISETIVIDDE
EDIETNGGAEKKSSCFIEWGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGD
LFQNGEFATHHSPDSWISQSASFPSNQKQPGVDSLSPVALLRKQNFQPTAQQQLTKPAKI
TCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVIL
PVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHEVSVNNVTHKLCS
NHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMMETK
SKKLTASENRKRNAFREENEKQLYGSSNTLMKKIEGIPEKKEKTSQLQLSVECGTDTLLI
QESVNLPPPSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVP
PQVRNFNFPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQ
LKNENGCKDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKKNKAIDAAERRLYENEKND
GVLLLYT
Download sequence
Identical sequences G3SAR5
ENSGGOP00000023119 XP_018895498.1.27298 XP_018895499.1.27298 XP_018895500.1.27298 ENSGGOP00000025188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]