SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SB88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SB88
Domain Number 1 Region: 75-355
Classification Level Classification E-value
Superfamily L domain-like 1.02e-50
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 31-94
Classification Level Classification E-value
Superfamily L domain-like 0.00000918
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Weak hits

Sequence:  G3SB88
Domain Number - Region: 411-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000137
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SB88
Sequence length 649
Comment (tr|G3SB88|G3SB88_GORGO) Fibronectin leucine rich transmembrane protein 3 {ECO:0000313|Ensembl:ENSGGOP00000025364} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FLRT3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MISPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
ETIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences G3SB88
ENSGGOP00000025364 XP_004061875.1.27298 XP_004061876.1.27298 XP_018872934.1.27298 ENSGGOP00000025364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]