SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SBB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3SBB5
Domain Number - Region: 210-238
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0958
Family Serum albumin-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SBB5
Sequence length 292
Comment (tr|G3SBB5|G3SBB5_GORGO) Mitochondrial fission regulator 1 like {ECO:0000313|Ensembl:ENSGGOP00000025391} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MTFR1L OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVP
TLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKP
ALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHS
TTSFVISDITEETEVEVPELPSVPLLCSASPECCKLEHKAACSSSEEDDCVSLSKASSFA
DMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
Download sequence
Identical sequences G3SBB5
XP_004025246.1.27298 XP_004025248.1.27298 XP_004025249.1.27298 ENSGGOP00000025391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]