SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SC36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SC36
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.39e-20
Family FHA domain 0.0041
Further Details:      
 
Domain Number 2 Region: 114-183
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000291
Family BRCT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SC36
Sequence length 720
Comment (tr|G3SC36|G3SC36_GORGO) Nibrin {ECO:0000256|PIRNR:PIRNR011869} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NBN OC=Catarrhini; Hominidae; Gorilla.
Sequence
MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQT
DEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCL
DVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFIEF
LKAVQSKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSS
AVVFGGGEARLITEENEEEHNFFLAPGSCVVDTGITNSQTLIPDCQKKWIQSIMDMLQLK
TTTPGPSLSQGLSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFR
MFSQDAPTVKESCKTSSNNNSMVSDTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNS
IRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPV
DTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPEL
EIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSA
KEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYP
GAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Download sequence
Identical sequences G3SC36
ENSGGOP00000025663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]