SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SE60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SE60
Domain Number 1 Region: 392-650
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-66
Family Nuclear receptor ligand-binding domain 0.000000000746
Further Details:      
 
Domain Number 2 Region: 320-397
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-28
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SE60
Sequence length 652
Comment (tr|G3SE60|G3SE60_GORGO) Nuclear receptor subfamily 4 group A member 1 {ECO:0000313|Ensembl:ENSGGOP00000026390} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NR4A1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTSAQYKIKILIEGLHHGQRPGPAPPRQPGSFCWALKADGIMWLAKACWSIQSEMPCIQA
QYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDT
FLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSS
SGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQP
PAFFSFSPPTGPSPSLAQSPLKLFPSQAPHQLGEGESYSMPTAFPGLAPTSPHLEGSGIL
DAPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLAN
KDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLT
SLVRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPG
FAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSI
LAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEP
QPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Download sequence
Identical sequences G3SE60
ENSGGOP00000006277 ENSGGOP00000006277 XP_004053205.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]