SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SEZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SEZ8
Domain Number 1 Region: 340-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-46
Family SPRY domain 0.0075
Further Details:      
 
Weak hits

Sequence:  G3SEZ8
Domain Number - Region: 111-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0125
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SEZ8
Sequence length 597
Comment (tr|G3SEZ8|G3SEZ8_GORGO) ASH2 like histone lysine methyltransferase complex subunit {ECO:0000313|Ensembl:ENSGGOP00000026682} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ASH2L OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAAAGAGPGQEAGAGPGPGAAANATGAEEGEMKPVAAGAAAPPGEGTSAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKIIFYKNGVNQGVAYKDIFEGVYFPAISLYKS
CTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences G3SEZ8
XP_004046971.1.27298 ENSGGOP00000005661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]