SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SGJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SGJ7
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.88e-82
Family MHC antigen-recognition domain 0.000000033
Further Details:      
 
Domain Number 2 Region: 210-300
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-30
Family C1 set domains (antibody constant domain-like) 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SGJ7
Sequence length 365
Comment (tr|G3SGJ7|G3SGJ7_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000027233} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HLA-A OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAVVAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWMEQEEPEYWDRQTQISKTNAQIELESLRIALRYYNQSEDGSHTIQ
RMYGCDVGSDGRFLRGYQQDAYDGKDYIASNEDLRSWTAADMAAEITKRKWEAAHFAEQL
RAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHPVSDHEAILRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPIVGIIAGLVLFGAVIAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDVSL
TACKV
Download sequence
Identical sequences G3SGJ7
ENSGGOP00000027233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]