SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SGL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SGL3
Domain Number 1 Region: 341-633
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-76
Family Kelch motif 0.0000155
Further Details:      
 
Domain Number 2 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  G3SGL3
Domain Number - Region: 270-349
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0994
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SGL3
Sequence length 655
Comment (tr|G3SGL3|G3SGL3_GORGO) Kelch like family member 13 {ECO:0000313|Ensembl:ENSGGOP00000027249} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=KLHL13 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQS
SKAGPTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYG
HAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVI
GGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNR
CMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
Download sequence
Identical sequences A0A0D9S096 A0A2I3HVT1 A0A2I3MUN4 A0A2K5HIN9 A0A2K5NFQ3 A0A2K5XPH4 G3SGL3 G7NT75 G7Q3I8 Q9P2N7
ENSP00000262820 gi|45643138|ref|NP_277030.2| ENSPANP00000010064 NP_277030.2.87134 NP_277030.2.92137 XP_004092545.1.23891 XP_005594488.1.63531 XP_008017717.1.81039 XP_008017718.1.81039 XP_008017719.1.81039 XP_011529713.1.92137 XP_011804093.1.43180 XP_011832519.1.47321 XP_011943015.1.92194 XP_011943016.1.92194 XP_011943017.1.92194 XP_014983552.1.72884 XP_014983553.1.72884 XP_018875353.1.27298 ENSGGOP00000027249 ENSP00000262820 9606.ENSP00000262820 ENSGGOP00000027249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]