SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SGT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SGT3
Domain Number 1 Region: 29-237,298-355
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.18e-26
Family D-aminoacid oxidase, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 224-310
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.76e-22
Family D-aminoacid oxidase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SGT3
Sequence length 369
Comment (tr|G3SGT3|G3SGT3_GORGO) D-aspartate oxidase {ECO:0000313|Ensembl:ENSGGOP00000027320} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DDO OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRPARHWETRFGARDFGGFQDCFFRDRPMDTARIAVVGAGVVGLSTAVCISKLVPRCSIT
IISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLV
SGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEK
RIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVE
HFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIR
EKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVCAL
RTPIPKSNL
Download sequence
Identical sequences G3SGT3
ENSGGOP00000015944 ENSGGOP00000015944 ENSGGOP00000027320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]