SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SHH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SHH4
Domain Number 1 Region: 369-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000121
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 813-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000736
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 1012-1062
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000136
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 330-339
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  G3SHH4
Domain Number - Region: 429-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00717
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SHH4
Sequence length 1078
Comment (tr|G3SHH4|G3SHH4_GORGO) Zinc finger protein 827 {ECO:0000313|Ensembl:ENSGGOP00000027562} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ZNF827 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPRRKQEQPKRLPSHVSRQEEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSTTPSSHTLELVALDSEVLRDSLQCQDHLSPGVSSLCDDDPGSNKPLS
SNLRRLLEAGSLKLDAAATANGRMESPVNVGSNLSFSPPSHHAQQLSVLARKLAEKQEQN
DQYTPSNRFIWNQGKWLPNSTTTCSLSPDSAILKLKAAANAVLQDKSLTRTEETMRFESF
SSPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAAG
SLLAEKSSLLPEDPLPPPPSEKKPEKVTPPPPPPPPPPPPQSLELLLLPVPKGRVSKPSN
SASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSHMKV
HQHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDVKGSPHLSDS
ACLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFTLNAADR
PANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEEPKEG
ESLSTTLPRSSYVFSPESEVSAPGVSEDALKPQEGKGSVLRRDVSVKAASELLMKLSAES
YKETQMVKIKEEPMEVDIQDSHVSISPSRNVGYSTLIGREKTEPLQKMPEGRVPPERNLF
SQDISVKMASELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDTFRQSPFTSNSKELLPS
DSVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHTEER
KYKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCHVCG
FETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSES
NSPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMPGSQPSLNSEEKPEKGFECVF
CNFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNSGQW
Download sequence
Identical sequences G3SHH4
ENSGGOP00000004604 XP_018881127.1.27298 ENSGGOP00000027562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]