SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SIB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SIB6
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SIB6
Sequence length 196
Comment (tr|G3SIB6|G3SIB6_GORGO) SPRY domain containing 7 {ECO:0000313|Ensembl:ENSGGOP00000027856} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SPRYD7 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences G1QUC7 G3SIB6 H2R1A5
ENSPTRP00000042045 XP_003809860.1.60992 XP_012362308.1.23891 XP_018895275.1.27298 XP_018895277.1.27298 XP_522757.2.37143 ENSPTRP00000042045 ENSNLEP00000004547 9598.ENSPTRP00000042045 ENSNLEP00000004547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]