SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SID3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SID3
Domain Number 1 Region: 366-492
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-26
Family SH2 domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SID3
Sequence length 495
Comment (tr|G3SID3|G3SID3_GORGO) Src homology 2 domain containing E {ECO:0000313|Ensembl:ENSGGOP00000027873} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SHE OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQWSPTPGASACLGWASSLACSTAPTLLGRAGRGPLMAAKWFKEFPLNLKTVSERAKPGG
GGGKLRKNSEAGGAGPGPGKGRKNSAAELGSGRAGVGPKDSRLSRDSLQGLIQAAAGKGR
KNSRATEEEPHRGATKSSGCSTYINRLIKVDTQEKNGKSSYPSSSSSSSSSSSSASSSPS
SLGPELDKGKIIKQQDTVIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYDAQQMITE
IRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPYEPAEGG
PRAEGKARPPDSRLPENDERPAAEYEQPWEWKKEQIVRALSVQFEGAERPSVREETVRQH
HRQKSWTQKILKPALSDHSEGEKVDPGLPLEKQPWYHGAISRAEAESRLQPCKEAGYLVR
NSESGNSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNEKLPFKG
AEHMTLLYPVHSKLH
Download sequence
Identical sequences G3SID3
ENSGGOP00000015395 XP_004026866.1.27298 ENSGGOP00000015395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]