SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SIF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SIF3
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-27
Family SH2 domain 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3SIF3
Sequence length 352
Comment (tr|G3SIF3|G3SIF3_GORGO) Hematopoietic SH2 domain containing {ECO:0000313|Ensembl:ENSGGOP00000027893} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HSH2D OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLEALVTFHQQKPIEPRREL
LTQPCRQKDPANADYEDLFLYSNAVAEEAACPVSATEEASPKPVLCHQSKERKPSAEMNR
ITTKEATSSCPAKAPLGETRQKLWRSLKMLPERGQRVRQQLKSHLATVNLSSLLDVRRST
VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCI
EVTPGDMSWHQMVVRALSSQESKPEHQGLADPENDQLPEEYQQPPPFAPGYC
Download sequence
Identical sequences G3SIF3
ENSGGOP00000027893 ENSGGOP00000000043 XP_004060270.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]