SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SJH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SJH4
Domain Number 1 Region: 74-359
Classification Level Classification E-value
Superfamily L domain-like 1.25e-56
Family Ngr ectodomain-like 0.000000138
Further Details:      
 
Weak hits

Sequence:  G3SJH4
Domain Number - Region: 7-55
Classification Level Classification E-value
Superfamily ARM repeat 0.00964
Family Armadillo repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SJH4
Sequence length 381
Comment (tr|G3SJH4|G3SJH4_GORGO) Asporin {ECO:0000256|RuleBase:RU364095} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ASPN OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKEYVLLLFLALCSAKPFFSPSHTALKNMMLKDMEDTDDDDDDDDDDDDDDDEDNSLFPT
REPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKE
NDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIH
ENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGL
PPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENN
KLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEM
QPATFRCVLSRMSVQLGNFGM
Download sequence
Identical sequences G3SJH4
ENSGGOP00000028264 ENSGGOP00000001938 XP_004048312.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]