SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SK56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SK56
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily L domain-like 4e-40
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 231-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000213
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SK56
Sequence length 428
Comment (tr|G3SK56|G3SK56_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000028499} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSAN
RLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHN
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINDN
PFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASS
QPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFH
GKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQRPPGLLLLGQSLL
LLFFLTSF
Download sequence
Identical sequences G3SK56
ENSGGOP00000010955 ENSGGOP00000028499 XP_004056532.1.27298 XP_004056536.1.27298 XP_018866401.1.27298 XP_018866402.1.27298 ENSGGOP00000010955 ENSGGOP00000028499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]